shkolaw.in.ua 1
Маїло Дмитро Степанович


Київський національний університет імені Тараса Шевченка
Клонування та очистка антигену для отримання моноклональних антитіл проти рецептору фактору росту фібробластів 1 ( FGFR-1)
Науковий напрямок: Біологія та біотехнологія
Список ключових слів: FGF- фактори росту фібробластів; FGFR- рецептори факторів росту фібробластів; FGFR-1- рецептор фактору росту фібробластів 1; MAPK- мітоген активовані протеїнкінази; PLC gamma- фосфоліпаза гамма

Вступ
Фактори росту фібробластів – FGFs – індукують різноманітні біологічні відповіді у клітин, а саме проліфератину активність клітин, їхню диференціацію та морфогенез (Basilico & Moscatelli, 1992 )(1). Також доведено, що FGFs приймають участь у ангіогенезі та ембріональному розвитку організму. Характерним для родини FGF є їх висока афінність до гепарину та геперинсульфату (Burgess, W.H. & T. Maciag 1989; Ornitz, D.M. et al. 1996)(2-3). Іншим характерним аспектом для факторів росту фібробластів є спільність у будові центрального корового сегменту, що складається із 140 амінокислотних залишків, які є високогомологічними серед усіх членів родини. Цей центральний коровий сегмент молекули фактору росту фібробластів складається в результаті фолдингу у структуру з дванадцяти антипаралельних β-ланцюгів, що формують циліндричну структуру ( Ago et al. 1991 )(4) . На даний час відомо 22 різних факторів росту фібробластів (FGF) у хребетних, які позначаються літерами від 1 до 22 (Burgess, W.H. & T. Maciag 1989 )(3).

Рецептори факторів росту фібробластів (FGFRs) включають 5 членів даної родини, а саме FGFR-1, FGFR-2, FGFR-3, FGFR-4 та FGFR-5( Kim et al. 2001; Sleeman et al. 2001)(5). Члени даної родини мають високий ступінь подібності у амінокислотній послідовності - до 54-70% гомології(Johnson and Williams, 1993)(6), - що вказує на еволюційну спорідненість даної групи генів. FGFR-5 має найбільш віддалену спорідненість поміж членів родини FGFR, так як ступінь його амінокислотної гомології складає лише 30%. Усі члени даної родини мають подібну загальну будову молекули. Всі вони складаються з таких основних частин: зовнішньоклітинного домену, що містить три імуноглобуліноподібних петелі (D1, D2, D3), поєднані дисульфідними містками; трансмембранного сегмента та внутрішньоклітинної ділянки, яка має тирозинкіназну активність( Coutts JC, and Gallagher JT. 1995 )(7). Просторова організація молекули FGFR-1 представлена на рис.1.




Рис. 1 Просторова організація молекули FGFR-1
Завдяки альтернативному сплайсингу чотирьох генів FGF рецепторів може утворитись більш ніж 48 різних ізоформ FGFR (Duchesne L, Tissot B. et al. 2006 )(8).

В неактивному стані рецептор являє собою мономерну форму, але після зв’язування відповідного FGF відбувається димеризація FGFR і, відповідно, активація даного рецептора. Активований тирозинкіназний домен ( McKeehan et al. 1998 )(9) передає сигнал до інших внутрішньоклітинних месенджерів декількох суміжних сигнальних шляхів, а саме: 1) Ras / MAPK сигнального ланцюга (Ong et al. 2000)(10); 2) сигнального шляху PLC gamma (Böttcher RT, Niehrs C. 2005)(11); 3) Crk каскаду (Kouhara et al. 1997; Hadari et al. 2001)(12-13). Результатом активації вищенаведених сигнальних шляхів є генерація відповідних біологічних відповідей у клітини, а саме активація клітинної проліферації, морфогенезу, руху клітин та інших біологічних процесів. Важливою функцією FGF рецепторів є вплив сигналу від даних рецепторів на розвиток і формування кінцівок організму.

Мутації у даних рецепторах (FGFR) можуть викликати розвиток різних патологічних процесів у організмі тварини. У більшості випадків мутації призводять до зміненої активності рецепторів, але є випадки, зокрема синдром Каллмана, що є результатом мутації із втратою функції. Найвідомішими синдромами, пов’язаними з дисфункцією, або гіперфункцією даного рецептора є: синдром Пфайфера, синдром Джексона-Вайса, синдром Каллмана, синдром Аперта, ахондроплазія (Muenke and Schell, 1995; Passos- Bueno et al. 1999)(14-15), гіпохондроплазія, синдром Муенке. Крім того варто зазначити, що порушення експресії FGFR1 дикого типу (надекспресія) спостерігається при злоякісній трансформації деяких тканин. Порушення нормального рівня експресії спостерігається при таких проліферативних новоутвореннях як: астроцитома, рак молочної залози, аденокарцинома підшлункової залози та при раку простати.


Виходячи з вищенаведеного, актуальним стає вивчення ролі рецептора FGFR1 у сигналінгу нормальних і трансформованих клітин. Одним із необхідних інструментів для детекції рецептора FGFR1 є високоспецифічні моноклональні антитіла. Таким чином, результати, представлені у роботі, є першим кроком у створенні моноклональних антитіл до рецептора FGFR1.

Метою даної роботи було створення антигену для використання у імунізації мишей та скринуванні гібридомних клонів. Відповідно до мети роботи були поставлені такі задачі:


  1. Провести порівняльний аналіз передбачених епітопів у зовнішньоклітинних доменах рецепторів родини FGFR.

  2. Клонувати послідовність, що кодує петлі II-III зовнішньоклітинного домена рецептора FGFR-1 у вектор для бактеріальної експресії pET42a.

  3. Перевірити експресію створеного конструкта у клітинах бактерій.

  4. Очистити експресований білок за допомогою афінної хроматографії на Ni-NTA.

5. Оцінити концентрацію рекомбінантного білка.
Основна частина
Пошук унікального епітопу за допомогою Bcepred software.

Для пошуку можливих унікальних епітопів у зовнішньоклітинному домені рецептора FGFR1 нами було використано ресурс Bcepred (http://www.imtech.res.in/raghava/bcepred/). Даний ресурс дозволяє передбачити потенційні епітопи для В-клітин, що базується на дослідженні і порівнянні фізико-хімічних властивостей антигену, що досліджується. У результаті дослідження було виявлено, що використання як антигену ділянки молекули у межах петель II-III FGFR-1 підвищує наші шанси відібрати моноклональні антитіла, що розпізнаватимуть виключно рецептор FGFR1. Таким чином, для клонування у вектор pET42a було вирішено використати ділянку кДНК, що кодує петлі II-III рецептора FGFR1. ( результати аналізу наведені нижче):

fgfr1c KTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCI 231


Клонування антигену у вектор pET42a.

Нуклеотидна послідовність, що кодує петлі II-III FGFR-1 була перевірена на її здатність розрізатися специфічними рестриктазами за допомогою програми NEBcutter (http://tools.neb.com/NEBcutter2/index.php). На рисунку 8 представлені можливі сайти рестрикції ділянки петель ІІ-ІІІ, які не можуть бути використані при дизайні праймерів для клонування. За результатом проведеного аналізу із отриманого списку (таблиця 1) було вибрано специфічні сайти для ендонуклеаз рестрикції BamHI та XhoI, що були використані при створенні праймерів:

Прямий праймер (BamHI як сайт рестрикції):

TTAGGATCCATGCCCGTAGCTCCATATTG

Зворотній праймер (XhoI як сайт рестрикції):

TTACTCGAGTCAGATCTCCAGGTACAGGG
ПЛР петель II-III FGFR-1.

Для отримання достатньої кількості вставки (петель II-III) було проведено полімеразну ланцюгову реакцію (ПЛР) із використанням створених праймерів.



1 2 3

Рис. 2 Електрофореграма результатів ПЛР аналізу. 1 – ампліфікована послідовність FGFR1- петлі ІІ-ІІІ. 2 – маркер, 3 – негативний контроль.
Рестрикція та лігування петель II-III у вектор pET42a.

Для рестрикції та лігування було обрано вектор pET42a. Для клонування петль II-III у дані вектори було обрані рестрикційні сайти BamHІ та XhoI. Наявність вставки у рекомбінантних плазмідах після лігування було перевірено за допомогою рестрикційного аналізу з наступним електрофорезом у агарозному гелі.

Виділення рекомбінантних плазмід та рестрикційний аналіз на наявність вставки.

Плазмідну ДНК виділяли з використанням QIAGEN Plasmid Purification kit (QIAGEN), дотримуючись рекомендацій виробника. Аліквоту з розчину кожної очищені плазміди піддавали рестрикційному аналізу за допомогою рестриктаз BamHI та XhoI протягом години на 37ОС. Потім продукти рестрикції розділяли у 0.7% агарозному гелі та фотографували. Результати рестрикційного аналізу на наявність вставки наведено на рис. 3.




Рис. 3 Електрофореграма рестрикційного аналізу. 1-4 послідовність FGFR1- петлі ІІ-ІІІ. 5- маркер.

На рис. 12 можна побачити отримані результати, що свідчать про успішність лігування вставки (доріжки 1-3). На доріжці 4 видно тільки пустий вектор.
Трансформація створеним конструктом клітин BL(DE3)р
LysE.

Для експресії рекомбінантних білків, послідовності яких заклоновано у вектор системи рЕТ широко використовуються бактеріальні клітини штаму BL(DE3)pLysE, тому що заклонована послідовність у векторі рЕТ42а стоїть під промотором Т7 полімерази, яку експресують клітини даного штаму, на відміну від клітин штаму XL1. Крім того, штам BL(DE3)LysE містить декілька мутацій у генах певних протеаз, що підвищує загальну кількість експресованого білка та знижує процент його деградації. Виходячи з того, отриману рекомбінантну плазміду із послідовністю, що кодую ділянку петель ІІ-ІІІ рецептора FGFR1, було використано для трансформації клітин BL(DE3)pLysE із наступним використанням їх для експресії й очистки рекомбінантного білка у достатній кількості.

Індукція експресії рекомбінантного білка.

Експресію проводили в штамі клітин E.coli BL(DE3)LysE. Для цього використовували стандартний протокол. Культури вирощувались на поживному середовищі LB, що містило 100 мкг/мл канаміцину для селекції клітин, трансформованих pET42a. Нічна культура розводилась 1/500 і вирощувалась до OD600=0,8 – 1,0 при температурі +37ОС. Експресію індукували додаванням IPTG до кінцевої концентрації 1 мМ і продовжували вирощувати культуру протягом 15 годин.


- + IPTG

Рис. 4. Електрофореграма результатів розділення бактеріальних лізатів у ПААГ. 1 – клітини вирощувалися без додавання IPTG, 2 – клітини вирощувалися із додаванням IPTG





51 кДа



1 2

Очистка і перевірка концентрації рекомбінантного білка.

Виходячи з того, що заклонована послідовність транслюється у рамці з тагами GST та 6хHis, очистку білка можна було проводити за допомогою афінної хроматографії як за GST так і за 6xHis, за умови розчинності білка. Але попередній аналіз лізатів показав, що весь рекомбінантний білок виявляється у нерозчинній фракції, що унеможливлює його очистку за GST-таг. Таким чином, очистка білка була здійснена із використанням Ni-NTA Agarose. Для цього 200 мл бактеріальної культури було очищено в денатуруючих умовах. Елюцію рекомбінантного білка з афінного носія проводили тричі у об”ємі 200 мкл елююючого буфера на кожну елюцію. Для перевірки концентрації білка використовувався протокол порівняльного електрофорезу в ПААГ з використанням BSA, для порівняння було використано BSA у концентраціях – 0.5, 1 та 2 мкг у зразку. З кожної елюції на гель наносили по 1 мкл у загальному об’ємі зразка 20 мкл.

51 кДа


Рис. 5 Електрофореграма результатів розділення білків у ПААГ. Оцінка концентрації білка. 1 - перша елюція, 2 - друга елюція, 3 - третя елюція, 4 - четверта елюція, 5 - BSA 0.25 мкг, 6- BSA 0.5 мкг, 7- BSA 1 мкг, 8 - маркер.

У результаті проведення данного аналізу, концентрація рекомбінантного білка виявилась у межах 0.5 мкг/мкл, що є оптимальною концентрацією для подальшої імунізації мишей для отримання моноклональних антитіл проти петель II-III FGFR-1.


Висновки

У результаті проведеної роботи було виконано наступні задачі:

1. Проведено пошук ділянки із потенційним унікальним епітопом FGFR1 за допомогою порівняльного аналізу зовнішньоклітинних доменів відомих репепторів родини FGFR.

2. На основі вектора pET42a створено рекомбінантну плазміду, що містить послідовність, яка кодує петлі II-III рецептора FGFR-1.


3. Експресію отриманого конструкта перевірено у клітинах бактерій.

4. Рекомбінантний білок очищено у достатній для проведення імунізації кількості за допомогою афінної хроматографії на Ni-NTA.

5. Чистоту очищення антигену та його концентрацію перевірено за допомогою ПААГ.

6. Отриманий білок із концентрацією 0.5 мкг/мкл, буде використано для імунізації мишей для отримання моноклональних антитіл проти петель II-III FGFR-1.

Моноклональні антитіла проти петель II-III рецептора FGFR-1, можуть бути використані:


  1. У дослідницьких цілях - дослідження клітинного сигналізингу FGFR-1 при певних проліферативних новоутвореннях.

  2. Діагностичні цілі ( імуноцитохімія, імуногістохімія, та використання даних антитіл у Вестерн блот аналізі та ELISA ).


Список літератури:



  1. Basilico C & Moscatelli D 1992 The FGF family of growth factors and oncogenes. / Advances in Cancer Research 59 115–165.

  2. Ornitz DM: FGFs, heparan sulfate and FGFRs: complex interaction essential for development. / BioEssays 2000, 22:108-112.

  3. Burgess, W.H. & T. Maciag (1989) / Annu. Rev. Biochem. 58:575.

  4. Ago H, Kitagawa Y, Fujishima A, Matsuura Y & Katsube Y 1991 Crystal structure of basic fibroblast growth factor at 1.6 A resolution. / Journal of Biochemistry 110 360–363.

  5. KIM, I., MOON, S.-O., YU, K.-H., KIM, U.-H. and KOH, G.Y. (2001). A novel fibroblast growth factor receptor-5 preferentially expressed in the pancreas. / Biochem. Biophys. Acta 1518: 152-156.

  6. Johnson and Williams (2005). "Receptors for fibroblast growth factors". / Immunol. Cell. Biol. 91 (6): 584-589.

  7. Coutts JC, and Gallagher JT. (1995). "Receptors for fibroblast growth factors and their isoforms". / Immunol. Cell. Biol. 73 (6): 584-589.
  8. Duchesne L, Tissot B. et al (2006). "N-glycosylation of fibroblast growth factor receptor 1 regulates ligand and heparan sulfate co-receptor binding". / J. Biol. Chem. 281 (37): 27178-27189.


  9. MCKEEHAN, W.L., WANG, F. and KAN, M. (1998). The heparan sulfate-fibroblast growth factor family: diversity of structure and function. / Prog. Nucleic Acid Res. Mol. Biol. 59: 135-176.

  10. ONG, S.H., GUY, G.R., HADARI, Y.R., LAKS, S., GOTOH, N., SCHLESSINGER, J. and LAX, I. (2000). FRS2 proteins recruit intracellular signaling pathways by binding diverse taregets on fibroblast growth factor and nerve growth factor receptors. / Mol. Cell. Biol. 20: 979-989.

  11. Böttcher RT, Niehrs C. (2005). "Fibroblast growth factor signaling during early vertebrate development". / Endocr. Rev. 26 (1): 63-77.

  12. KOUHARA, H., HADARI, Y.R., SPIVAK-KROIZMAN, T., SCHILLING, J., BAR-SAGI, D., LAX, I. and SCHLESSINGER, J. (1997). A lipid-anchored Grb2-binding protein that links FGF-receptor activiation to the Ras/MAPK signaling pathway. / Cell 89: 693-702.

  13. HADARI, Y.R., GOTOH, N., KOUHARA, H., LAX, I. and SCHLESSINGER, J. (2001). Critical role for the docking-protein FRS2in FGF receptor-mediated signal transduction pathways./ Proc. Natl. Acad. Sci. USA 98: 8578-8583.

  14. MUENKE, M. and SCHELL, U. (1995). Fibroblast-growth-factor receptor mutations in human skeletal disorders. / Trends Genet. 11: 308-313.

  15. PASSOS-BUENO, M.R., WILCOX, W.R., JABS, E.W., SERTIE, A.L., ALONSO, L.G. and KITOH, H. (1999). Clinical spectrum of fibroblast growth factor receptor mutations. / Hum. Mutat. 14: 115-125.